PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37431.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 151aa    MW: 16935.9 Da    PI: 10.1582
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37431.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-143781347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       KHN37431.1 37 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 81
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.9473086IPR017930Myb domain
SuperFamilySSF466891.73E-173287IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-173385IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-113480IPR009057Homeodomain-like
SMARTSM007177.3E-113484IPR001005SANT/Myb domain
PfamPF002492.9E-123781IPR001005SANT/Myb domain
CDDcd001671.38E-103782No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MPLSGGAGIS TWDNANQISF GSKLKQQGEN ERKKGTPWTE EEHRLFLIGL SKFGKGDWRS  60
ISRNVVVTRT PTQVASHAQK YFLRQNSVKK ERKRSSIHDI TTVDSNSAPM PIDQTWVPPP  120
GGSVQQSQQY PSSNMHDQMG TFGYSNYGFD M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0830270.0AB083027.1 Glycine max mRNA for syringolide-induced protein 1-3-1A, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237360.11e-108syringolide-induced protein 1-3-1A
SwissprotQ8S9H73e-39DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2RSM51e-110A0A0B2RSM5_GLYSO; Transcription factor MYB1R1
STRINGGLYMA10G42450.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-51MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]